Structure of PDB 7yzd Chain A Binding Site BS02

Receptor Information
>7yzd Chain A (length=112) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YQRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNYKGW
RDSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTVEVNRIPLELLKRQNTAV
SRFAQDLAPYIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yzd Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1.
Resolution2.13 Å
Binding residue
(original residue number in PDB)		Y92 Q93 R94 Y95 K97 S101 Y102 Y138 D143 S144 H147 Y152 Q166 K168 Q187
Binding residue
(residue number reindexed from 1)		Y1 Q2 R3 Y4 K6 S10 Y11 Y47 D52 S53 H56 Y61 Q75 K77 Q96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yzd, PDBe:7yzd, PDBj:7yzd
PDBsum7yzd
PubMed36435807
UniProtQ9I9E1|FOXH1_DANRE Forkhead box protein H1 (Gene Name=foxh1)

[Back to BioLiP]