Structure of PDB 7yz7 Chain A Binding Site BS02

Receptor Information
>7yz7 Chain A (length=120) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNYQRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNYK
GWRDSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTVEVNRIPLELLKRQNT
AVSRQDETIFAQDLAPYIFQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yz7 Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1.
Resolution0.98 Å
Binding residue
(original residue number in PDB)		K90 Y92 Q93 Y95 K97 S101 Y102 Y138 D143 S144 H147 Y152 Q166 K168 L183 Q187
Binding residue
(residue number reindexed from 1)		K1 Y3 Q4 Y6 K8 S12 Y13 Y49 D54 S55 H58 Y63 Q77 K79 L94 Q98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yz7, PDBe:7yz7, PDBj:7yz7
PDBsum7yz7
PubMed36435807
UniProtQ9I9E1|FOXH1_DANRE Forkhead box protein H1 (Gene Name=foxh1)

[Back to BioLiP]