Structure of PDB 7yuk Chain A Binding Site BS02

Receptor Information
>7yuk Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDY
LFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDWYRIK
QSIDSKCRTAWRRKQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yuk Structural insights into DNA recognition by the BEN domain of the transcription factor BANP.
Resolution2.11 Å
Binding residue
(original residue number in PDB)		S271 G274 H276 K278 R316 W319 R320
Binding residue
(residue number reindexed from 1)		S63 G66 H68 K70 R108 W111 R112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7yuk, PDBe:7yuk, PDBj:7yuk
PDBsum7yuk
PubMed37086783
UniProtQ8N9N5|BANP_HUMAN Protein BANP (Gene Name=BANP)

[Back to BioLiP]