Structure of PDB 7ysf Chain A Binding Site BS02

Receptor Information
>7ysf Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHFCPVCLRAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLRRHCN
IHAGLRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPICRLRFTEANT
LRRHAKRKHPEAM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ysf Crystal structure of ZNF524 ZF1-4 in complex with telomeric DNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Y125 S127 S155 E181 G183 N211 R214
Binding residue
(residue number reindexed from 1)
Y13 S15 S43 E69 G71 N99 R102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ysf, PDBe:7ysf, PDBj:7ysf
PDBsum7ysf
PubMed38086788
UniProtQ96C55|ZN524_HUMAN Zinc finger protein 524 (Gene Name=ZNF524)

[Back to BioLiP]