Structure of PDB 7yrg Chain A Binding Site BS02

Receptor Information
>7yrg Chain A (length=100) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ
SSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>7yrg Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yrg Structural insight into H4K20 methylation on H2A.Z-nucleosome by SUV420H1.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		K37 R40 Y41 V46 A47 R49 L65 P66 R69 R83
Binding residue
(residue number reindexed from 1)		K2 R5 Y6 V11 A12 R14 L30 P31 R34 R48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7yrg, PDBe:7yrg, PDBj:7yrg
PDBsum7yrg
PubMed37536340
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]