Structure of PDB 7y43 Chain A Binding Site BS02

Receptor Information
>7y43 Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLE
LSVKDGTILKVSNKGLNSYKDPDNPGRIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y43 The histone acetyltransferase KAT6A is recruited to unmethylated CpG islands via a DNA binding winged helix domain.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		K21 K24 Q25 R26 R79
Binding residue
(residue number reindexed from 1)		K19 K22 Q23 R24 R77
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7y43, PDBe:7y43, PDBj:7y43
PDBsum7y43
PubMed36537216
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]