Structure of PDB 7y3l Chain A Binding Site BS02

Receptor Information
>7y3l Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQHNCQSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVHM
GTHMWNN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3l Structural studies of SALL family protein zinc finger cluster domains in complex with DNA reveal preferential binding to an AATA tetranucleotide motif.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H1131 R1148 N1155 H1159
Binding residue
(residue number reindexed from 1)		H21 R38 N45 H49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7y3l, PDBe:7y3l, PDBj:7y3l
PDBsum7y3l
PubMed36257403
UniProtQ9BXA9|SALL3_HUMAN Sal-like protein 3 (Gene Name=SALL3)

[Back to BioLiP]