Structure of PDB 7xv8 Chain A Binding Site BS02

Receptor Information
>7xv8 Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIIN
KHHRNRCQFCRLKKCLEMGMKMESVQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xv8 Structures of human TR4LBD-JAZF1 and TR4DBD-DNA complexes reveal the molecular basis of transcriptional regulation.
Resolution3.199 Å
Binding residue
(original residue number in PDB)		E135 G136 R143 R166 N167 Q170
Binding residue
(residue number reindexed from 1)		E23 G24 R31 R54 N55 Q58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xv8, PDBe:7xv8, PDBj:7xv8
PDBsum7xv8
PubMed36651297
UniProtP49116|NR2C2_HUMAN Nuclear receptor subfamily 2 group C member 2 (Gene Name=NR2C2)

[Back to BioLiP]