Structure of PDB 7xq5 Chain A Binding Site BS02

Receptor Information
>7xq5 Chain A (length=75) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLTDGQIRINHVSSEKKRRELERAIFDELVAVVPDLQPQESRSELIIYL
KSLSYLSWLYERNEKLRKQIIAKHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xq5 Structural Analysis of Ino2p/Ino4p Mutual Interactions and Their Binding Interface with Promoter DNA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		L3 H12 E16 R19
Binding residue
(residue number reindexed from 1)		L3 H12 E16 R19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:7xq5, PDBe:7xq5, PDBj:7xq5
PDBsum7xq5
PubMed35886947
UniProtP13902|INO4_YEAST Protein INO4 (Gene Name=INO4)

[Back to BioLiP]