Structure of PDB 7xjo Chain A Binding Site BS02

Receptor Information

>7xjo Chain A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NFFPRKPKWDKNQITYRIIGYTPDLAPETVDDAFARAFQVWSDVTPLRFS
RIYDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDD
ELWTLGKGVGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLS
QDDIKGIQELYGASPD

Ligand information

>7xjo Chain D (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PEDPLE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7xjo Discovery of Aryloxyphenyl-Heptapeptide Hybrids as Potent and Selective Matrix Metalloproteinase-2 Inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	V93 G94
Binding residue (residue number reindexed from 1)	V91 G92

Enzymatic activity

Enzyme Commision number

3.4.24.24: gelatinase A.

Gene Ontology

	Molecular Function
GO:0004222	metalloendopeptidase activity
GO:0008237	metallopeptidase activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0031012	extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xjo, PDBe:7xjo, PDBj:7xjo
PDBsum	7xjo
PubMed	35687819
UniProt	P08253\|MMP2_HUMAN 72 kDa type IV collagenase (Gene Name=MMP2)

[Back to BioLiP]