Structure of PDB 7xhv Chain A Binding Site BS02

Receptor Information
>7xhv Chain A (length=177) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKERLARENHSEIERRRRNKMTAYITELSDMVPTCSAARKPDKLTILRMA
VSHMKSLRGPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPV
LNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSGSRRSFICRMRCGTSSVF
VVVHCTGYIKAWPPAGFCLVAIGRLQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xhv Structures of NPAS4-ARNT and NPAS4-ARNT2 heterodimers reveal new dimerization modalities in the bHLH-PAS transcription factor family.
Resolution3.996 Å
Binding residue
(original residue number in PDB)
H94 I97 E98 R101
Binding residue
(residue number reindexed from 1)
H10 I13 E14 R17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7xhv, PDBe:7xhv, PDBj:7xhv
PDBsum7xhv
PubMed36343253
UniProtP53762|ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator (Gene Name=Arnt)

[Back to BioLiP]