Structure of PDB 7wwv Chain A Binding Site BS02

Receptor Information
>7wwv Chain A (length=179) Species: 1296592 (Vibrio phage ICP1_2011_A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIKEMIEDFISKGGLIFTHSGRYTNTNNSCFIFNKNDIGVDTKVDMYTPK
SAGIKNEEGENLWQVLNKANMFYRIYSGELGEELQYLLKSCCTAKEDVTT
LPQIYFKNGEGYDILVPIGNAHNLISGTEYLWEHKYYNTFTQKLGGSNPQ
NCTHACNKMRGGFKQFNCTPPQVEDNYNA
Ligand information
>7wwv Chain O (length=46) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttaaatagggaagataagcaaagggttgacgaaagccctttgtccc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wwv Mechanistic insights into DNA binding and cleavage by a compact type I-F CRISPR-Cas system in bacteriophage.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R22 K50 S147 N148 N151
Binding residue
(residue number reindexed from 1)		R22 K50 S147 N148 N151
Enzymatic activity
Enzyme Commision number ?
External links