Structure of PDB 7vp7 Chain A Binding Site BS02

Receptor Information
>7vp7 Chain A (length=57) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKA
KTAIDKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vp7 Structural basis for DNA recognition by TCP transcription factors
Resolution2.653 Å
Binding residue
(original residue number in PDB)		R32 R46 R68 P69
Binding residue
(residue number reindexed from 1)		R2 R16 R38 P39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7vp7, PDBe:7vp7, PDBj:7vp7
PDBsum7vp7
PubMed
UniProtO82277|TCP10_ARATH Transcription factor TCP10 (Gene Name=TCP10)

[Back to BioLiP]