Structure of PDB 7vp1 Chain A Binding Site BS02

Receptor Information
>7vp1 Chain A (length=65) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHIIRATRKDRHSKVFTSKGPRDRRVRMSAHTAIQFYDVQDRLGYDRPSK
AVDWLIKKAKTAIDK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vp1 Structural basis for DNA recognition by TCP transcription factors
Resolution2.902 Å
Binding residue
(original residue number in PDB)		R46 R48 S50
Binding residue
(residue number reindexed from 1)		R25 R27 S29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7vp1, PDBe:7vp1, PDBj:7vp1
PDBsum7vp1
PubMed
UniProtO82277|TCP10_ARATH Transcription factor TCP10 (Gene Name=TCP10)

[Back to BioLiP]