Structure of PDB 7vox Chain A Binding Site BS02

Receptor Information
>7vox Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNS
IRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vox FOXL2 and FOXA1 cooperatively assemble on the TP53 promoter in alternative dimer configurations.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L193 R219 H220 S223 K230 K240 G241 S242 W244
Binding residue
(residue number reindexed from 1)		L26 R52 H53 S56 K63 K73 G74 S75 W77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7vox, PDBe:7vox, PDBj:7vox
PDBsum7vox
PubMed35920317
UniProtP55317|FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha (Gene Name=FOXA1)

[Back to BioLiP]