Structure of PDB 7vov Chain A Binding Site BS02

Receptor Information
>7vov Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSI
RHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vov FOXL2 and FOXA1 cooperatively assemble on the TP53 promoter in alternative dimer configurations.
Resolution3.15 Å
Binding residue
(original residue number in PDB)
Y8 E71
Binding residue
(residue number reindexed from 1)
Y7 E70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7vov, PDBe:7vov, PDBj:7vov
PDBsum7vov
PubMed35920317
UniProtP58012|FOXL2_HUMAN Forkhead box protein L2 (Gene Name=FOXL2)

[Back to BioLiP]