Structure of PDB 7vjm Chain A Binding Site BS02

Receptor Information
>7vjm Chain A (length=73) Species: 1223260 (Pseudomonas phage JBD30) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKTPDASNHDPDPRYLRGLLKKAGISQRRAAELLGLSDRVMRYYLSEDIK
EGYRPAPYTVQFALECLANDPPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vjm Structural basis for anti-CRISPR repression mediated by bacterial operon proteins Aca1 and Aca2.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R22 S31 Q32 R33 R44 R47 Y48
Binding residue
(residue number reindexed from 1)		R17 S26 Q27 R28 R39 R42 Y43
Enzymatic activity
Enzyme Commision number ?
External links