Structure of PDB 7v9i Chain A Binding Site BS02

Receptor Information
>7v9i Chain A (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLSDKEVREIVQQSLSVGNFAARLLVRLFPELFTTENLRLQYNHSGACNK
KQLDPTRLRLIRHYVEAVYPRAKNDRVWHYECIPSIDERCRRPNRKKCDI
LKKAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v9i Highly enriched BEND3 prevents the premature activation of bivalent genes during differentiation.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		H760 K766 H795 R807 K812 K813
Binding residue
(residue number reindexed from 1)		H44 K50 H79 R91 K96 K97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000183 rDNA heterochromatin formation
Cellular Component
GO:0000792 heterochromatin

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v9i, PDBe:7v9i, PDBj:7v9i
PDBsum7v9i
PubMed35143257
UniProtQ6PAL0|BEND3_MOUSE BEN domain-containing protein 3 (Gene Name=Bend3)

[Back to BioLiP]