Structure of PDB 7v99 Chain A Binding Site BS02

Receptor Information
>7v99 Chain A (length=991) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALV
AQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGF
ALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVH
LLARCALFVLVAPSCAYQVCGPPLYQLGAAPPVYAETKHFLYSSGDKEQL
RPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRP
LFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEE
DTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNT
KKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEIL
AKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQ
HLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVG
ARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWR
TFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCV
RRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVV
IEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLL
CSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGV
PEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLE
VQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQV
NSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTAS
LCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVP
LLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v99 Zipper head mechanism of telomere synthesis by human telomerase.
Resolution3.54 Å
Binding residue
(original residue number in PDB)		V867 S948 T959 K973 K981
Binding residue
(residue number reindexed from 1)		V726 S807 T818 K832 K840
Enzymatic activity
Enzyme Commision number 2.7.7.49: RNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001223 transcription coactivator binding
GO:0003677 DNA binding
GO:0003720 telomerase activity
GO:0003723 RNA binding
GO:0003964 RNA-directed DNA polymerase activity
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0042162 telomeric DNA binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0051087 protein-folding chaperone binding
GO:0070034 telomerase RNA binding
GO:0098680 template-free RNA nucleotidyltransferase
Biological Process
GO:0000723 telomere maintenance
GO:0001172 RNA-templated transcription
GO:0006278 RNA-templated DNA biosynthetic process
GO:0007004 telomere maintenance via telomerase
GO:0007005 mitochondrion organization
GO:0010629 negative regulation of gene expression
GO:0022616 DNA strand elongation
GO:0030177 positive regulation of Wnt signaling pathway
GO:0030422 siRNA processing
GO:0031647 regulation of protein stability
GO:0032092 positive regulation of protein binding
GO:0042635 positive regulation of hair cycle
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045766 positive regulation of angiogenesis
GO:0046326 positive regulation of D-glucose import
GO:0046686 response to cadmium ion
GO:0051000 positive regulation of nitric-oxide synthase activity
GO:0070200 establishment of protein localization to telomere
GO:0071456 cellular response to hypoxia
GO:0071897 DNA biosynthetic process
GO:0090399 replicative senescence
GO:0140745 siRNA transcription
GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
GO:1902895 positive regulation of miRNA transcription
GO:1903620 positive regulation of transdifferentiation
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
GO:1904751 positive regulation of protein localization to nucleolus
GO:1904754 positive regulation of vascular associated smooth muscle cell migration
GO:2000352 negative regulation of endothelial cell apoptotic process
GO:2000648 positive regulation of stem cell proliferation
GO:2000773 negative regulation of cellular senescence
GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
Cellular Component
GO:0000333 telomerase catalytic core complex
GO:0000781 chromosome, telomeric region
GO:0000783 nuclear telomere cap complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016605 PML body
GO:0016607 nuclear speck
GO:0031379 RNA-directed RNA polymerase complex
GO:0042645 mitochondrial nucleoid
GO:0043231 intracellular membrane-bounded organelle
GO:1990572 TERT-RMRP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v99, PDBe:7v99, PDBj:7v99
PDBsum7v99
PubMed34782750
UniProtO14746|TERT_HUMAN Telomerase reverse transcriptase (Gene Name=TERT)

[Back to BioLiP]