Structure of PDB 7uzx Chain A Binding Site BS02

Receptor Information

>7uzx Chain A (length=204) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YSKIKISGTIEVVTGLHIGGGGSPVVRDLQTKLPIIPGSSIKGKMRNLLA
KHFGLKMKQESHNQDDERVLRLFGSSEKGNIQRARLQISDAFFSEKTKEH
FAQNDIAYTETKFENTINRLTAVANPRQIERVTRGSEFDFVFIYNVDEES
QVEDDFENIEKAIHLLENDYLGGGGTRGNGRIQFKDTNIETVVGEYDSTN
LKIK

Ligand information

>7uzx Chain L (length=5) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aauga

.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7uzx Structures of an active type III-A CRISPR effector complex.
Resolution	3.49 Å
Binding residue (original residue number in PDB)	V133 A134 P136
Binding residue (residue number reindexed from 1)	V123 A124 P126

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0004519	endonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0051607	defense response to virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7uzx, PDBe:7uzx, PDBj:7uzx
PDBsum	7uzx
PubMed	35714601
UniProt	Q5HK91

[Back to BioLiP]