Structure of PDB 7uhe Chain A Binding Site BS02

Receptor Information
>7uhe Chain A (length=71) Species: 4930 (Saccharomyces) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFII
DLYSLPEGLLKSLWDYVKKNT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uhe Taf2 mediates DNA binding of Taf14.
Resolution1.66 Å
Binding residue
(original residue number in PDB)
E178 K179 F182
Binding residue
(residue number reindexed from 1)
E8 K9 F12
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7uhe, PDBe:7uhe, PDBj:7uhe
PDBsum7uhe
PubMed35676274
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]