Structure of PDB 7ubl Chain A Binding Site BS02

Receptor Information
>7ubl Chain A (length=141) Species: 2681611 (Escherichia phage Lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLATFAYADYCRS
AATPGARCRDCHGTGRAVDIAKTKLWGRVVEKECGRCKGVGYSRMPASAA
YRAVTMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADNI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ubl In transcription antitermination by Q lambda , NusA induces refolding of Q lambda to form a nozzle that extends the RNA polymerase RNA-exit channel.
Resolution2.177 Å
Binding residue
(original residue number in PDB)
R82 R119 R146 K148 R154 T172 T175 R178
Binding residue
(residue number reindexed from 1)
R22 R59 R86 K88 R94 T112 T115 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7ubl, PDBe:7ubl, PDBj:7ubl
PDBsum7ubl
PubMed35951650
UniProtP03047|REGQ_LAMBD Antitermination protein Q (Gene Name=Q)

[Back to BioLiP]