Structure of PDB 7txj Chain A Binding Site BS02

Receptor Information
>7txj Chain A (length=153) Species: 346882 (Betalipothrixvirus pozzuoliense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLSQASVLRYYAKRFTMNVGTTAHVLGKEVAGNPWVAKAIDKLSYQETYN
WISDYQASHLAKQVAKQVAEKYGIPPTFQGLLMAYAEKVVANYILDYKGE
SLTQMHDNYLYELMQKMPSSGYIYVFIGKDGKTHTVDMSKVLTDIEDALL
KRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7txj Cryo-EM of AFV6
Resolution3.9 Å
Binding residue
(original residue number in PDB)
R7 S12 K19 M23 W57 P82
Binding residue
(residue number reindexed from 1)
R1 S6 K13 M17 W51 P76
Enzymatic activity
Enzyme Commision number ?
External links