Structure of PDB 7tfl Chain A Binding Site BS02

Receptor Information

>7tfl Chain A (length=338) Species: 4932 (Saccharomyces cerevisiae)

REEDKLWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKDGSGVFRAAM
LYGPPGIGKTTAAHLVAQELGYDILEKHFVIIMDEVDGMSGGDRGGVGQL
AQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTI
AIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENINEIS
KAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPL
MIQENYLSTRPSVLKPGQSHLEAVAEAANCISLGDIVEKKIRSSEQLWSL
LPLHAVLSSVYPASKVAGHMAGRINFTAWLGQNSKSAK

Ligand information

>7tfl Chain J (length=11)

acgagtacata

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7tfl Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
• Resolution: 3.33 Å
• Binding residue (original residue number in PDB): F582 W638 S639 P642
• Binding residue (residue number reindexed from 1): F242 W298 S299 P302

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003689 DNA clamp loader activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0000278 mitotic cell cycle
• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006271 DNA strand elongation involved in DNA replication
• GO:0006272 leading strand elongation
• GO:0006281 DNA repair
• GO:0006298 mismatch repair
• GO:0051301 cell division

Cellular Component

• GO:0005634 nucleus
• GO:0005663 DNA replication factor C complex

External links

• PDB: RCSB:7tfl, PDBe:7tfl, PDBj:7tfl
• PDBsum: 7tfl
• PubMed: 35829698
• UniProt: P38630|RFC1_YEAST Replication factor C subunit 1 (Gene Name=RFC1)