Structure of PDB 7tea Chain A Binding Site BS02

Receptor Information
>7tea Chain A (length=76) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLND
LERLLEIKSLLEKGFNIKEIKQIYDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tea Molecular dissection of the glutamine synthetase-GlnR nitrogen regulatory circuitry in Gram-positive bacteria.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		S17 R28 R31 R43 K48 R49
Binding residue
(residue number reindexed from 1)		S12 R23 R26 R38 K43 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7tea, PDBe:7tea, PDBj:7tea
PDBsum7tea
PubMed35778410
UniProtQ2FYY7

[Back to BioLiP]