Structure of PDB 7t1l Chain A Binding Site BS02

Receptor Information
>7t1l Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESETVKGAYALSVLWDGLP
RHFLIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t1l Engineered SH2 Domains for Targeted Phosphoproteomics.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		E35 T36 V37 K38 A40
Binding residue
(residue number reindexed from 1)		E34 T35 V36 K37 A39
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:7t1l, PDBe:7t1l, PDBj:7t1l
PDBsum7t1l
PubMed35613471
UniProtP07332|FES_HUMAN Tyrosine-protein kinase Fes/Fps (Gene Name=FES)

[Back to BioLiP]