Structure of PDB 7swy Chain A Binding Site BS02

Receptor Information
>7swy Chain A (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVAREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7swy Chain J (length=143) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggatgtatatatctgacacgtgcctggagactagggagtaatccccttgg
cggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggttgctaga
gctgtctacgaccaattgagcggcctcggcaccgggattctcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7swy Nucleosome recognition and DNA distortion by the Chd1 remodeler in a nucleotide-free state.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R40 Y41 P43 R49 R63 L65 R69
Binding residue
(residue number reindexed from 1)		R2 Y3 P5 R10 R24 L26 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7swy, PDBe:7swy, PDBj:7swy
PDBsum7swy
PubMed35173352
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]