Structure of PDB 7s6m Chain A Binding Site BS02

Receptor Information

>7s6m Chain A (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFS
CFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFG
ALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFR
EISYLKKLKVKKQDRIFPP

Ligand information

>7s6m Chain M (length=5) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgtcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s6m Captured snapshots of PARP1 in the active state reveal the mechanics of PARP1 allostery.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	S16 R18 A19 S20 K22 R34 F44 V48 S274 G275
Binding residue (residue number reindexed from 1)	S11 R13 A14 S15 K17 R29 F39 V43 S134 G135

Enzymatic activity

Enzyme Commision number

2.4.2.-
2.4.2.30: NAD(+) ADP-ribosyltransferase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:7s6m, PDBe:7s6m, PDBj:7s6m
PDBsum	7s6m
PubMed	35793673
UniProt	P09874\|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 (Gene Name=PARP1)

[Back to BioLiP]