Structure of PDB 7rg3 Chain A Binding Site BS02

Receptor Information

>7rg3 Chain A (length=425) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLI
PKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL
ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTL
ACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS
CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIV
TGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ
QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGI
IEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD
KIEALQRHENESVYKASLNLIEKYF

Ligand information

>7rg3 Chain C (length=8) Species: 1335626 (Middle East respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SPTKKLRY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7rg3 MERS-CoV ORF4b employs an unusual binding mechanism to target IMP alpha and block innate immunity.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	S105 W142 N146 S149 G150 T151 T155 Q181 W184 N188 G191 D192 W231 R238 D270 W273
Binding residue (residue number reindexed from 1)	S34 W71 N75 S78 G79 T80 T84 Q110 W113 N117 G120 D121 W160 R167 D199 W202

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0061608	nuclear import signal receptor activity

	Biological Process
GO:0006606	protein import into nucleus

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7rg3, PDBe:7rg3, PDBj:7rg3
PDBsum	7rg3
PubMed	35338144
UniProt	P52293\|IMA1_MOUSE Importin subunit alpha-1 (Gene Name=Kpna2)

[Back to BioLiP]