Structure of PDB 7ray Chain A Binding Site BS02

Receptor Information
>7ray Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSEVYYFSPSGKKFRSKP
QLARYLGNTVDLSSFDFRTGKMMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ray Crystal structure of MBD2 with DNA
Resolution1.78 Å
Binding residue
(original residue number in PDB)		R166 K167 S168 G169 L170 S171 K186
Binding residue
(residue number reindexed from 1)		R25 K26 S27 G28 L29 S30 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7ray, PDBe:7ray, PDBj:7ray
PDBsum7ray
PubMed
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]