Structure of PDB 7qxa Chain A Binding Site BS02

Receptor Information
>7qxa Chain A (length=954) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQ
CLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFAL
LPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFV
LVAPSCAYQVCGPPLYQLGPPVYAETKHFLYSSGDKEQLRPSFLLSSLRP
SLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQ
CPYGVLLKTHCPLRADPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLW
GSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGC
VPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRK
SVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPD
GLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGA
SVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEV
IASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVA
HLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQC
QGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLT
HAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLF
PWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVL
RLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKN
PTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAF
LLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFK
TILD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qxa Structural basis of human telomerase recruitment by TPP1-POT1.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q177 H500 F645 H752 F759 Q794 L866 D868 C931 Y949 S957 T959 F964 R968 R972 K973 G976 L980 R1011
Binding residue
(residue number reindexed from 1)		Q167 H322 F467 H574 F581 Q616 L688 D690 C753 Y771 S779 T781 F786 R790 R794 K795 G798 L802 R833
Enzymatic activity
Enzyme Commision number 2.7.7.49: RNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001223 transcription coactivator binding
GO:0003677 DNA binding
GO:0003720 telomerase activity
GO:0003723 RNA binding
GO:0003964 RNA-directed DNA polymerase activity
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0042162 telomeric DNA binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0051087 protein-folding chaperone binding
GO:0070034 telomerase RNA binding
GO:0098680 template-free RNA nucleotidyltransferase
Biological Process
GO:0000723 telomere maintenance
GO:0001172 RNA-templated transcription
GO:0006278 RNA-templated DNA biosynthetic process
GO:0007004 telomere maintenance via telomerase
GO:0007005 mitochondrion organization
GO:0010629 negative regulation of gene expression
GO:0022616 DNA strand elongation
GO:0030177 positive regulation of Wnt signaling pathway
GO:0030422 siRNA processing
GO:0031647 regulation of protein stability
GO:0032092 positive regulation of protein binding
GO:0042635 positive regulation of hair cycle
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045766 positive regulation of angiogenesis
GO:0046326 positive regulation of D-glucose import
GO:0046686 response to cadmium ion
GO:0051000 positive regulation of nitric-oxide synthase activity
GO:0070200 establishment of protein localization to telomere
GO:0071456 cellular response to hypoxia
GO:0071897 DNA biosynthetic process
GO:0090399 replicative senescence
GO:0140745 siRNA transcription
GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
GO:1902895 positive regulation of miRNA transcription
GO:1903620 positive regulation of transdifferentiation
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
GO:1904751 positive regulation of protein localization to nucleolus
GO:1904754 positive regulation of vascular associated smooth muscle cell migration
GO:2000352 negative regulation of endothelial cell apoptotic process
GO:2000648 positive regulation of stem cell proliferation
GO:2000773 negative regulation of cellular senescence
GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
Cellular Component
GO:0000333 telomerase catalytic core complex
GO:0000781 chromosome, telomeric region
GO:0000783 nuclear telomere cap complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016605 PML body
GO:0016607 nuclear speck
GO:0031379 RNA-directed RNA polymerase complex
GO:0042645 mitochondrial nucleoid
GO:0043231 intracellular membrane-bounded organelle
GO:1990572 TERT-RMRP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qxa, PDBe:7qxa, PDBj:7qxa
PDBsum7qxa
PubMed35201900
UniProtO14746|TERT_HUMAN Telomerase reverse transcriptase (Gene Name=TERT)

[Back to BioLiP]