Structure of PDB 7q94 Chain A Binding Site BS02

Receptor Information

>7q94 Chain A (length=267) Species: 176299 (Agrobacterium fabrum str. C58) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELIAVVTAITTDEPRVMTVREGAALPSGPFEFGHRTLQSGLREWIHEQTH
HPVGYLEQLYTFADRDRNNGRTISIGYLGLVREFWHGWYEYFPWEDHRQG
RPDILDSIIDKLRAWADSEPDSRAQRHLRADFTFGLDGGGWNEELTLQRY
ELLYEAGLVGEAQSEPRINFGRPMFADHRRILATGIARLRAKIKYRPVVF
ELMADSFTLLQLQRAIEALAGLTLHKQNFRRLIEQQQLVEETGDMATETG
GRPAKLFRFRQTVLDER

Ligand information

>7q94 Chain D (length=31) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aagacatattctcattgtgagcatatgtcaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q94 Bacterial NadQ (COG4111) is a Nudix-like, ATP-responsive regulator of NAD biosynthesis.
Resolution	4.3 Å
Binding residue (original residue number in PDB)	H246 Q248 N249 R252 G272 R273
Binding residue (residue number reindexed from 1)	H225 Q227 N228 R231 G251 R252

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding

View graph for
Molecular Function

External links

PDB	RCSB:7q94, PDBe:7q94, PDBj:7q94
PDBsum	7q94
PubMed	36332744
UniProt	A9CG24

[Back to BioLiP]