Structure of PDB 7ozq Chain A Binding Site BS02

Receptor Information
>7ozq Chain A (length=123) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKL
VIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVA
IIEPGKARDLVEEIAMKVKELMK
Ligand information
>7ozq Chain H (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guacuagauuggucgaaaggcuaauugaugac
......<<<<<<<<....>>>>>>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ozq Eukaryotic Box C/D methylation machinery has two non-symmetric protein assembly sites.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		R33 K34 G35 T36 N37 E38 K41 R45 V57 D58 I62 K83 I92 E93 V94 A95 A96 A97
Binding residue
(residue number reindexed from 1)		R33 K34 G35 T36 N37 E38 K41 R45 V57 D58 I62 K83 I92 E93 V94 A95 A96 A97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ozq, PDBe:7ozq, PDBj:7ozq
PDBsum7ozq
PubMed34475498
UniProtQ8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]