Structure of PDB 7oy7 Chain A Binding Site BS02

Receptor Information
>7oy7 Chain A (length=242) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMIARIIGEIGIEGARFIEENIDEQFKALRYLSKGIDSETFVKLVIAN
SLVSYQLTGKGEQWWWEFAKYFYGRDVKSIYLAYKEFLPNSRFNRRLIPQ
KLSRIRRVETFLSTLTEERIEEYYGDMSSLWGSIARALGVDKESKTVVFS
VKMFGYAARIVLSTFNPYPMEIPIPEDSRIVKLTKKLTNEKPRKFWMKIA
RESGVPPLHIDSILWPLLGGASIDSAPPELRDKLAELIKIIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oy7 Structural and functional determinants of the archaeal 8-oxoguanine-DNA glycosylase AGOG for DNA damage recognition and processing.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R92 R93 L94
Binding residue
(residue number reindexed from 1)		R95 R96 L97
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0000702 oxidized base lesion DNA N-glycosylase activity
GO:0003824 catalytic activity
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0016787 hydrolase activity
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829 lyase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7oy7, PDBe:7oy7, PDBj:7oy7
PDBsum7oy7
PubMed36300625
UniProtQ9UZY0|AGOG_PYRAB N-glycosylase/DNA lyase (Gene Name=PYRAB10170)

[Back to BioLiP]