Structure of PDB 7oxk Chain A Binding Site BS02

Receptor Information

>7oxk Chain A (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNP
MPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP

Ligand information

>7oxk Chain C (length=11) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TRYKNAKMLPF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7oxk Impact of distant peptide substrate residues on enzymatic activity of SlyD.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Q72 V74 A78 F79 P80 Q90 F91 Y92 Q94
Binding residue (residue number reindexed from 1)	Q72 V74 A78 F79 P80 Q90 F91 Y92 Q94

Enzymatic activity

Enzyme Commision number

5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0042026	protein refolding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7oxk, PDBe:7oxk, PDBj:7oxk
PDBsum	7oxk
PubMed	35184231
UniProt	Q5SLE7

[Back to BioLiP]