Structure of PDB 7oxi Chain A Binding Site BS02

Receptor Information

>7oxi Chain A (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNP
MPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP

Ligand information

>7oxi Chain C (length=11) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TRYANAKMLPF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7oxi Impact of distant peptide substrate residues on enzymatic activity of SlyD.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Q72 S77 A78 F79 P80 Q90 F91 Y92 A93 M96
Binding residue (residue number reindexed from 1)	Q72 S77 A78 F79 P80 Q90 F91 Y92 A93 M96

Enzymatic activity

Enzyme Commision number

5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0042026	protein refolding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7oxi, PDBe:7oxi, PDBj:7oxi
PDBsum	7oxi
PubMed	35184231
UniProt	Q5SLE7

[Back to BioLiP]