Structure of PDB 7nx5 Chain A Binding Site BS02

Receptor Information
>7nx5 Chain A (length=62) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCP
SLDVDSIIPRTP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nx5 Structural basis of DNA methylation-dependent site selectivity of the Epstein-Barr virus lytic switch protein ZEBRA/Zta/BZLF1.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R179 N182 R183 R187 R190 K194
Binding residue
(residue number reindexed from 1)		R6 N9 R10 R14 R17 K21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7nx5, PDBe:7nx5, PDBj:7nx5
PDBsum7nx5
PubMed34893887
UniProtP03206|BZLF1_EBVB9 Lytic switch protein BZLF1 (Gene Name=BZLF1)

[Back to BioLiP]