Structure of PDB 7nhq Chain A Binding Site BS02

Receptor Information
>7nhq Chain A (length=335) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVD
IDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNG
GPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFL
IYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGA
LFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLI
FQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDA
KGNVINTWADIINRANLGMEVMHERNAHNFPLDLA
Ligand information
>7nhq Chain T (length=28) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
METITYVFIFACIIALFFFAIFFREPPR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nhq Structural insights into photosystem II assembly.
Resolution2.68 Å
Binding residue
(original residue number in PDB)		R27 L71 N76 E231 S232 Y235
Binding residue
(residue number reindexed from 1)		R18 L62 N67 E222 S223 Y226
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009635 response to herbicide
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhq, PDBe:7nhq, PDBj:7nhq
PDBsum7nhq
PubMed33846594
UniProtP0A444|PSBA1_THEVB Photosystem II protein D1 1 (Gene Name=psbA1)

[Back to BioLiP]