Structure of PDB 7n5u Chain A Binding Site BS02

Receptor Information
>7n5u Chain A (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVH
MRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n5u Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		K396 Q422 D423 K426 Y438
Binding residue
(residue number reindexed from 1)		K18 Q44 D45 K48 Y60
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7n5u, PDBe:7n5u, PDBj:7n5u
PDBsum7n5u
PubMed36626981
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]