Structure of PDB 7n5t Chain A Binding Site BS02

Receptor Information
>7n5t Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMR
KHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n5t Structural basis for human ZBTB7A action at the fetal globin promoter.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
Q422 D423 R430 Y438 K454 S478 D479 H482
Binding residue
(residue number reindexed from 1)
Q42 D43 R50 Y58 K74 S98 D99 H102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7n5t, PDBe:7n5t, PDBj:7n5t
PDBsum7n5t
PubMed34592153
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]