Structure of PDB 7mwm Chain A Binding Site BS02

Receptor Information
>7mwm Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GATESGKRMDCPALPPGWKKEEVIKKSGLSAGKSDVYYFSPSGKKFRSKP
QLARYLGNTVDLSSFDFRTGKMMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mwm Crystal structure of MBD2 with DNA
Resolution1.601 Å
Binding residue
(original residue number in PDB)		R188 S189 P191 R195
Binding residue
(residue number reindexed from 1)		R47 S48 P50 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7mwm, PDBe:7mwm, PDBj:7mwm
PDBsum7mwm
PubMed
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]