Structure of PDB 7mp3 Chain A Binding Site BS02

Receptor Information
>7mp3 Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRQGFVLSLCHLQK
VKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHC
CT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mp3 Enhancing the Bioactivity of Bicyclic Peptides Targeted to Grb7-SH2 by Restoring Cell Permeability.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
R438 R458 R462
Binding residue
(residue number reindexed from 1)
R14 R34 R38
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7mp3, PDBe:7mp3, PDBj:7mp3
PDBsum7mp3
PubMed35625882
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]