Structure of PDB 7lbw Chain A Binding Site BS02

Receptor Information
>7lbw Chain A (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lbw A minimal motif for sequence recognition by mitochondrial transcription factor A (TFAM).
Resolution2.84 Å
Binding residue
(original residue number in PDB)
K52 S55 Y57 T78 I81 A85 W88 R89 Y103 W107 R140
Binding residue
(residue number reindexed from 1)
K9 S12 Y14 T35 I38 A42 W45 R46 Y60 W64 R97
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lbw, PDBe:7lbw, PDBj:7lbw
PDBsum7lbw
PubMed34928349
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]