Structure of PDB 7kzg Chain A Binding Site BS02

Receptor Information
>7kzg Chain A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYP
SAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHG
IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kzg Structural Insights into the Mechanism of Base Excision by MBD4.
Resolution1.68 Å
Binding residue
(original residue number in PDB)		R468 M473 P505 G507 L508 Y509 D510 L511
Binding residue
(residue number reindexed from 1)		R32 M37 P69 G71 L72 Y73 D74 L75
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kzg, PDBe:7kzg, PDBj:7kzg
PDBsum7kzg
PubMed34107280
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]