Structure of PDB 7kz1 Chain A Binding Site BS02

Receptor Information
>7kz1 Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKY
PSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELH
GIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kz1 Structural Insights into the Mechanism of Base Excision by MBD4.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		R468 M473 K504 G507 L508 Y509 D510 L511
Binding residue
(residue number reindexed from 1)		R33 M38 K69 G72 L73 Y74 D75 L76
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kz1, PDBe:7kz1, PDBj:7kz1
PDBsum7kz1
PubMed34107280
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]