Structure of PDB 7k7g Chain A Binding Site BS02

Receptor Information
>7k7g Chain A (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQ
ESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGER
Ligand information
>7k7g Chain J (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttcttactatttcttttttaactttcggaaatcaaatacactaatattaa
aacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtcta
cgaccaattgagcggcctcggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		G45 T46 R64 R84
Binding residue
(residue number reindexed from 1)		G1 T2 R20 R40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008823 cupric reductase (NADH) activity
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006878 intracellular copper ion homeostasis
GO:0009060 aerobic respiration
GO:0009303 rRNA transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0043935 sexual sporulation resulting in formation of a cellular spore
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
PDBsum7k7g
PubMed33741944
UniProtP61830|H3_YEAST Histone H3 (Gene Name=HHT1)

[Back to BioLiP]