Structure of PDB 7jm4 Chain A Binding Site BS02

Receptor Information
>7jm4 Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAAL
FKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jm4 Structural determinants of the IRF4/DNA homodimeric complex.
Resolution2.95 Å
Binding residue
(original residue number in PDB)
G22 K23 L24 H56 K59 R64 K78 K80 R96 K103
Binding residue
(residue number reindexed from 1)
G2 K3 L4 H36 K39 R44 K58 K60 R76 K83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7jm4, PDBe:7jm4, PDBj:7jm4
PDBsum7jm4
PubMed33533913
UniProtQ15306|IRF4_HUMAN Interferon regulatory factor 4 (Gene Name=IRF4)

[Back to BioLiP]