Structure of PDB 7fef Chain A Binding Site BS02

Receptor Information
>7fef Chain A (length=48) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NWLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYLEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fef Family-wide Characterization of Methylated DNA Binding Ability of Arabidopsis MBDs.
Resolution2.39 Å
Binding residue
(original residue number in PDB)
R115 S116 T118
Binding residue
(residue number reindexed from 1)
R37 S38 T40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7fef, PDBe:7fef, PDBj:7fef
PDBsum7fef
PubMed34919920
UniProtQ9LTJ1|MBD6_ARATH Methyl-CpG-binding domain-containing protein 6 (Gene Name=MBD6)

[Back to BioLiP]