Structure of PDB 7f2f Chain A Binding Site BS02

Receptor Information
>7f2f Chain A (length=90) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPFQKQAHNKIEKRYRININTKIARLQQIIPWVASEQTAFEVGDSTKLN
KSMILEKAVDYILYLQNNERLYEMEVQRLKSEIDTLKQDQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f2f Crystal structure of the complex of DNA with the C-terminal domain of TYE7 from Saccharomyces cerevisiae.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		E189 Y192
Binding residue
(residue number reindexed from 1)		E13 Y16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:7f2f, PDBe:7f2f, PDBj:7f2f
PDBsum7f2f
PubMed
UniProtP33122|TYE7_YEAST Transcription factor TYE7 (Gene Name=TYE7)

[Back to BioLiP]