Structure of PDB 7et6 Chain A Binding Site BS02

Receptor Information
>7et6 Chain A (length=102) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LFEKTVTPSDVGKLNRLVIPKQHAEKHFPLPATKGVLINLEDRTGKVWRF
RYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQLYIHWKV
RS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7et6 TEM1 combinatorially binds to FLOWERING LOCUS T and recruits a Polycomb factor to repress the floral transition in Arabidopsis.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K197 T200 S202 L207 R209 V211 P213 K214 S262
Binding residue
(residue number reindexed from 1)		K4 T7 S9 L14 R16 V18 P20 K21 S58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7et6, PDBe:7et6, PDBj:7et6
PDBsum7et6
PubMed34446554
UniProtQ9C6M5|RAVL1_ARATH AP2/ERF and B3 domain-containing transcription repressor TEM1 (Gene Name=TEM1)

[Back to BioLiP]